We provide your pigeons and caged birds with the B complex vitamins they need, ensuring high performance with wheezing, easy breathing, immune-supporting properties, and excellent flight support.

Royal Ilaç Pigeorex Complementary Feed for Wheezing and Breath-Stimulating Pigeons and Cage Birds

Liquid complementary feed with expectorant (expectorant) effect for the protection of the respiratory tract

UsageInstructions:

For the relief of wheezingin animalsandexpectorationfor the purpose of5daysduration1ltwater1-2ml is recommended.

In pigeons:Racebeforeandafterrespiratorypathwaysto relax1literwater2-3ml is recommended.

For caged birds:Weekly1day1literper water1-2mlrateis recommended.

Royal Ilaç Aegean Oregano Natural Preservative

AegeanSeafrom the regionobtainedfromIzmiressentialoilcontainingedenliquidsupplementaryfeed.

Usage. It is used because it supports thebenefit..

Royal Ilaç Pigeotonic Amino Acid and Vitamin B Supplementary Feed

It is a complementary feed containing amino acids, electrolytes, and B Complex vitamins.It is a performance enhancer that can be used during the racing season,breeding season,breeding season,andbreeding season,year-round..

During the breeding period:1ltwateror1kgfood10mlmixedper week3daysgiven.

During the moulting period: 10 ml mixed into 1 liter of water or 1 kg of food and given 3 days a week.

Güvercin ve kafes kuslarinizin ihtiyaç duydugu B kompleks vitaminleri ile hirilti, rahat nefes, bagisiklik destekleyici özelligi, mükemmel uçus destegi ile kuslarinizi yüksek performans ile uçuruyoruz.

Royal Ilaç Pigeorex Güvercin Ve Kafes Kuslarinda Hirilti Ve Nefes Açici Tamamlayici Yem

Solunumyollarininnemininkorunmasindaveekspektoran(balgam söktürücü) etkili sivi tamamlayici yem.

Kullanmatalimati:

Hayvanlardaolusanhiriltiningiderilmesivebalgaminsöktürülmesiamaciyla5günsüre1ltsuya1-2ml kullanilmasi tavsiye edilir.

Güvercinlerde:Yarisöncesivesonrasindasolunumyollarininrahatlatilmasiamaciyla1litresuya2-3ml kullanilmasi tavsiye edilir.

Kafeskuslarinda:Haftada1gün1litresuya1-2mloranindakullanilmasitavsiyeedilmektedir.

Royal Ilaç Egenin Oregano Dogal Koruyucu

EgedeniziçevresindeneldeedilenIzmirkekigininesansiyelyaginiihtivaedensivitamamlayiciyem.

Kullanmatalimati:

Sindirim düzenleyici, bagisiklik kuvvetlendirici, bakterilere, mantarlara karsi direnç artirici etkisi ve kokusundandolayisuveyemtüketmekapasitesiniveyemdenyararlanmayidesteklemesindendolayi kullanilmaktadir.

Güvercinlerde ve kafes kuslarinda 2,5-3 ml 1 lt suya haftada 1-2 gün kullanilir.

Süpheliiltihapdurumlarinda3günarkaarkayakullanilabilir.

Royal Ilaç Pigeotonic Aminoasit ve B Vitamini Destekleyici Yem

Amino asit, elektrolit ve B Kompleks vitaminleri içeren tamamlayici yemdir.Yarismevsiminde,yetistirmedeveüremedöneminde,yilboyu kullanilabilen, performans arttiricidir.

Kullanmatalimati:

Yaris mevsiminde: 1 lt suya veya 1 kg mamaya 15 ml karistirilarak haftada 3 gün verilir.

Üremedöneminde:1ltsuyaveya1kgmamaya10mlkaristirilarakhaftada3günverilir.

Tüy döneminde: 1 lt suya veya 1 kg mamaya 10 ml karistirilarak haftada 3 gün verilir.